PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_18408.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 186aa    MW: 22132.4 Da    PI: 9.6721
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_18408.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM115.45.7e-363615312128
                      NAM  12 eelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                              +el+++yL++k+ + +le  + i e++iyk++P+ + +  k ++ ek wy  ++rd+ky++ +r++++t +gyWkatg d+++++ 
  Sme2.5_18408.1_g00001.1  36 SELITHYLERKIGNLRLEP-NKIYEMNIYKYDPKMIVAyvKPTTAEKVWYILTPRDRKYQNRHRPSKSTGNGYWKATGADRDIKDD 120
                              79**************999.77**************74235556888**************************************9 PP

                      NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                              k+  vg++k Lv+y g+apkg+kt+W+mheyrl
  Sme2.5_18408.1_g00001.1 121 KNVIVGVRKALVYYYGKAPKGQKTNWIMHEYRL 153
                              999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100539.20325180IPR003441NAC domain
SuperFamilySSF1019411.44E-4136179IPR003441NAC domain
PfamPF023655.1E-1836153IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
NLNLFDEKQN NMEFLDEDVD DVPIKGTRIL SDIYQSELIT HYLERKIGNL RLEPNKIYEM  60
NIYKYDPKMI VAYVKPTTAE KVWYILTPRD RKYQNRHRPS KSTGNGYWKA TGADRDIKDD  120
KNVIVGVRKA LVYYYGKAPK GQKTNWIMHE YRLTGVPDIS QRGPKDLKLD DWVLCRIRFM  180
HEYRLP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-393717729162NO APICAL MERISTEM PROTEIN
1ut4_B4e-393717729162NO APICAL MERISTEM PROTEIN
1ut7_A4e-393717729162NO APICAL MERISTEM PROTEIN
1ut7_B4e-393717729162NO APICAL MERISTEM PROTEIN
3swm_A5e-393717732165NAC domain-containing protein 19
3swm_B5e-393717732165NAC domain-containing protein 19
3swm_C5e-393717732165NAC domain-containing protein 19
3swm_D5e-393717732165NAC domain-containing protein 19
3swp_A5e-393717732165NAC domain-containing protein 19
3swp_B5e-393717732165NAC domain-containing protein 19
3swp_C5e-393717732165NAC domain-containing protein 19
3swp_D5e-393717732165NAC domain-containing protein 19
4dul_A4e-393717729162NAC domain-containing protein 19
4dul_B4e-393717729162NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016578729.15e-65PREDICTED: NAC domain-containing protein 72-like
RefseqXP_009793862.15e-65PREDICTED: NAC domain-containing protein 102-like
SwissprotQ390135e-44NAC2_ARATH; NAC domain-containing protein 2
TrEMBLM1BM462e-60M1BM46_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000482376e-60(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA139361213
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.13e-45NAC family protein